SCOP 1.69: Domain d1pmjx_: 1pmj X:

Lineage for d1pmjx_ (1pmj X:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families)

5. Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins)

6. Protein Beta-1,4-mannanase ManA [110118] (1 species)

7. Species Caldicellulosiruptor saccharolyticus [TaxId:44001] [110119] (2 PDB entries)

8. Domain d1pmjx_: 1pmj X: [104194]

Details for d1pmjx_

PDB Entry: 1pmj, 1.55 Å

PDB Description: Crystal structure of Caldicellulosiruptor saccharolyticus CBM27-1

SCOP Domain Sequences for d1pmjx_:

Sequence; same for both SEQRES and ATOM records:

>d1pmjx_ b.18.1.18 (X:) Beta-1,4-mannanase ManA {Caldicellulosiruptor saccharolyticus}
essvnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngw
dqgdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsef
nitanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvri
rpeda

Timeline for d1pmjx_:

• d1pmjx_ is new in SCOP 1.69
  
• d1pmjx_ appears in SCOP 1.71
  
• d1pmjx_ appears in the current release, SCOPe 2.08