| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins) |
| Protein Beta-1,4-mannanase ManA [110118] (1 species) |
| Species Caldicellulosiruptor saccharolyticus [TaxId:44001] [110119] (2 PDB entries) Uniprot P77847 36-220 |
| Domain d1pmjx_: 1pmj X: [104194] complexed with acy, ca, edo |
PDB Entry: 1pmj (more details), 1.55 Å
SCOPe Domain Sequences for d1pmjx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmjx_ b.18.1.18 (X:) Beta-1,4-mannanase ManA {Caldicellulosiruptor saccharolyticus [TaxId: 44001]}
essvnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngw
dqgdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsef
nitanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvri
rpeda
Timeline for d1pmjx_: