SCOPe 2.05: Domain d1pmhx_: 1pmh X:

Lineage for d1pmhx_ (1pmh X:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins)

6. Protein Beta-1,4-mannanase ManA [110118] (1 species)

7. Species Caldicellulosiruptor saccharolyticus [TaxId:44001] [110119] (2 PDB entries)
   Uniprot P77847 36-220

8. Domain d1pmhx_: 1pmh X: [104193]
   complexed with ca, edo

Details for d1pmhx_

PDB Entry: 1pmh, 1.06 Å

PDB Description: crystal structure of caldicellulosiruptor saccharolyticus cbm27-1 in complex with mannohexaose

PDB Compounds: (X:) beta-1,4-mannanase

SCOPe Domain Sequences for d1pmhx_:

Sequence; same for both SEQRES and ATOM records:

>d1pmhx_ b.18.1.18 (X:) Beta-1,4-mannanase ManA {Caldicellulosiruptor saccharolyticus [TaxId: 44001]}
svnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngwdq
gdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsefni
tanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvrirp
eda

Timeline for d1pmhx_:

• d1pmhx_ first appeared in SCOP 1.69
  
• d1pmhx_ appears in SCOPe 2.04
  
• d1pmhx_ appears in SCOPe 2.06
  
• d1pmhx_ appears in the current release, SCOPe 2.08