Lineage for d1pmhx_ (1pmh X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774781Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins)
  6. 2774782Protein Beta-1,4-mannanase ManA [110118] (1 species)
  7. 2774783Species Caldicellulosiruptor saccharolyticus [TaxId:44001] [110119] (2 PDB entries)
    Uniprot P77847 36-220
  8. 2774784Domain d1pmhx_: 1pmh X: [104193]
    complexed with ca, edo

Details for d1pmhx_

PDB Entry: 1pmh (more details), 1.06 Å

PDB Description: crystal structure of caldicellulosiruptor saccharolyticus cbm27-1 in complex with mannohexaose
PDB Compounds: (X:) beta-1,4-mannanase

SCOPe Domain Sequences for d1pmhx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmhx_ b.18.1.18 (X:) Beta-1,4-mannanase ManA {Caldicellulosiruptor saccharolyticus [TaxId: 44001]}
svnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngwdq
gdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsefni
tanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvrirp
eda

SCOPe Domain Coordinates for d1pmhx_:

Click to download the PDB-style file with coordinates for d1pmhx_.
(The format of our PDB-style files is described here.)

Timeline for d1pmhx_: