Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins) |
Protein Beta-1,4-mannanase ManA [110118] (1 species) |
Species Caldicellulosiruptor saccharolyticus [TaxId:44001] [110119] (2 PDB entries) Uniprot P77847 36-220 |
Domain d1pmhx_: 1pmh X: [104193] complexed with ca, edo |
PDB Entry: 1pmh (more details), 1.06 Å
SCOPe Domain Sequences for d1pmhx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmhx_ b.18.1.18 (X:) Beta-1,4-mannanase ManA {Caldicellulosiruptor saccharolyticus [TaxId: 44001]} svnpvvldfedgtvmsfgeawgdslkcikkvsvsqdlqrpgnkyalrldvefnpnngwdq gdlgtwiggvvegqfdftgyksvefemfipydefsksqggfaykvvindgwkelgsefni tanagkkvkingkdytvihkafaipedfrtkkraqlvfqfagqnsnykgpiyldnvrirp eda
Timeline for d1pmhx_: