Lineage for d1pm5a3 (1pm5 A:223-271)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 524023Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 524024Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 524038Species Lactococcus lactis [TaxId:1358] [81619] (6 PDB entries)
  8. 524043Domain d1pm5a3: 1pm5 A:223-271 [104192]
    Other proteins in same PDB: d1pm5a1, d1pm5a2

Details for d1pm5a3

PDB Entry: 1pm5 (more details), 1.95 Å

PDB Description: Crystal structure of wild type Lactococcus lactis Fpg complexed to a tetrahydrofuran containing DNA

SCOP Domain Sequences for d1pm5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm5a3 g.39.1.8 (A:223-271) DNA repair protein MutM (Fpg) {Lactococcus lactis}
salgstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOP Domain Coordinates for d1pm5a3:

Click to download the PDB-style file with coordinates for d1pm5a3.
(The format of our PDB-style files is described here.)

Timeline for d1pm5a3: