![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) ![]() |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries) |
![]() | Domain d1pm5a2: 1pm5 A:1-131 [104191] Other proteins in same PDB: d1pm5a1, d1pm5a3 complexed with 3dr, gol, zn |
PDB Entry: 1pm5 (more details), 1.95 Å
SCOP Domain Sequences for d1pm5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pm5a2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd qvlpyflkkki
Timeline for d1pm5a2: