SCOP 1.69: Domain d1pm1x_: 1pm1 X:

Lineage for d1pm1x_ (1pm1 X:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (3 PDB entries)

8. Domain d1pm1x_: 1pm1 X: [104189]

Details for d1pm1x_

PDB Entry: 1pm1, 1.1 Å

PDB Description: crystal structure of nitrophorin 2 l122v/l132v mutant complex with imidazole

SCOP Domain Sequences for d1pm1x_:

Sequence; same for both SEQRES and ATOM records:

>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
icvregskdlgdvytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d1pm1x_:

• d1pm1x_ is new in SCOP 1.69
  
• d1pm1x_ appears in SCOP 1.71
  
• d1pm1x_ appears in the current release, SCOPe 2.08