SCOP 1.69: Domain d1pl2b2: 1pl2 B:2-80

Lineage for d1pl2b2 (1pl2 B:2-80)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (15 PDB entries)

8. Domain d1pl2b2: 1pl2 B:2-80 [104185]
   Other proteins in same PDB: d1pl2a1, d1pl2b1

Details for d1pl2b2

PDB Entry: 1pl2, 1.8 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 t68e mutant in complex with decarboxy-glutathione

SCOP Domain Sequences for d1pl2b2:

Sequence; same for both SEQRES and ATOM records:

>d1pl2b2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqerailnyiaskyn

Timeline for d1pl2b2:

• d1pl2b2 is new in SCOP 1.69
  
• d1pl2b2 appears in SCOP 1.71
  
• d1pl2b2 appears in the current release, SCOPe 2.08