Lineage for d1pl2a2 (1pl2 A:2-80)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486664Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 486675Protein Class alpha GST [81360] (8 species)
  7. 486685Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (15 PDB entries)
  8. 486692Domain d1pl2a2: 1pl2 A:2-80 [104183]
    Other proteins in same PDB: d1pl2a1, d1pl2b1

Details for d1pl2a2

PDB Entry: 1pl2 (more details), 1.8 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 t68e mutant in complex with decarboxy-glutathione

SCOP Domain Sequences for d1pl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl2a2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqerailnyiaskyn

SCOP Domain Coordinates for d1pl2a2:

Click to download the PDB-style file with coordinates for d1pl2a2.
(The format of our PDB-style files is described here.)

Timeline for d1pl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pl2a1