Lineage for d1pl1a1 (1pl1 A:81-222)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 2321907Protein Class alpha GST [81349] (8 species)
  7. 2321920Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
    Uniprot P08263
  8. 2321925Domain d1pl1a1: 1pl1 A:81-222 [104178]
    Other proteins in same PDB: d1pl1a2, d1pl1b2
    complexed with aby, cl

Details for d1pl1a1

PDB Entry: 1pl1 (more details), 1.75 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 in complex with a decarboxy-glutathione
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1pl1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl1a1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1pl1a1:

Click to download the PDB-style file with coordinates for d1pl1a1.
(The format of our PDB-style files is described here.)

Timeline for d1pl1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pl1a2