SCOP 1.73: Domain d1pkza2: 1pkz A:2-80

Lineage for d1pkza2 (1pkz A:2-80)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (17 PDB entries)

8. Domain d1pkza2: 1pkz A:2-80 [104175]
   Other proteins in same PDB: d1pkza1, d1pkzb1

Details for d1pkza2

PDB Entry: 1pkz, 2.1 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1

PDB Compounds: (A:) glutathione s-transferase a1

SCOP Domain Sequences for d1pkza2:

Sequence; same for both SEQRES and ATOM records:

>d1pkza2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d1pkza2:

• d1pkza2 first appeared in SCOP 1.69
  
• d1pkza2 appears in SCOP 1.71
  
• d1pkza2 appears in SCOP 1.75
  
• d1pkza2 appears in the current release, SCOPe 2.08