SCOPe 2.07: Domain d1pkwb1: 1pkw B:81-222

Lineage for d1pkwb1 (1pkw B:81-222)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d1pkwb1: 1pkw B:81-222 [104172]
   Other proteins in same PDB: d1pkwa2, d1pkwb2
   complexed with gsh, hed

Details for d1pkwb1

PDB Entry: 1pkw, 2 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 in complex with glutathione

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1pkwb1:

Sequence; same for both SEQRES and ATOM records:

>d1pkwb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1pkwb1:

• d1pkwb1 first appeared in SCOP 1.69
  
• d1pkwb1 appears in SCOPe 2.06
  
• d1pkwb1 appears in the current release, SCOPe 2.08