![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries) |
![]() | Domain d1pkwa1: 1pkw A:81-222 [104170] Other proteins in same PDB: d1pkwa2, d1pkwb2 |
PDB Entry: 1pkw (more details), 2 Å
SCOP Domain Sequences for d1pkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkwa1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1)} lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmdeksleearkifrf
Timeline for d1pkwa1: