Lineage for d1pkvb_ (1pkv B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
    automatically mapped to Pfam PF00677
  6. Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
    Uniprot P29015 1-87
  8. Domain d1pkvb_: 1pkv B: [104169]
    complexed with rbf

Details for d1pkvb_

PDB Entry: 1pkv (more details), 2.6 Å

PDB Description: The N-terminal domain of riboflavin synthase in complex with riboflavin
PDB Compounds: (B:) riboflavin synthase alpha chain

SCOPe Domain Sequences for d1pkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkvb_ b.43.4.3 (B:) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera

SCOPe Domain Coordinates for d1pkvb_ are not available.

Timeline for d1pkvb_:

Domains from other chains:
(mouse over for more information)
d1pkva_