Lineage for d1pkva_ (1pkv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403227Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
    automatically mapped to Pfam PF00677
  6. 2403228Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 2403229Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
    Uniprot P29015 1-87
  8. 2403236Domain d1pkva_: 1pkv A: [104168]
    complexed with rbf

Details for d1pkva_

PDB Entry: 1pkv (more details), 2.6 Å

PDB Description: The N-terminal domain of riboflavin synthase in complex with riboflavin
PDB Compounds: (A:) riboflavin synthase alpha chain

SCOPe Domain Sequences for d1pkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkva_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera

SCOPe Domain Coordinates for d1pkva_:

Click to download the PDB-style file with coordinates for d1pkva_.
(The format of our PDB-style files is described here.)

Timeline for d1pkva_: