SCOPe 2.01: Domain d1pkva_: 1pkv A:

Lineage for d1pkva_ (1pkv A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains

6. Protein Riboflavin synthase [63784] (2 species)
   trimerizes via the additional C-terminal helix

7. Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
   Uniprot P29015 1-87

8. Domain d1pkva_: 1pkv A: [104168]
   complexed with rbf

Details for d1pkva_

PDB Entry: 1pkv, 2.6 Å

PDB Description: The N-terminal domain of riboflavin synthase in complex with riboflavin

PDB Compounds: (A:) riboflavin synthase alpha chain

SCOPe Domain Sequences for d1pkva_:

Sequence; same for both SEQRES and ATOM records:

>d1pkva_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera

Timeline for d1pkva_:

• d1pkva_ first appeared in SCOP 1.69
  
• d1pkva_ appears in SCOP 1.75
  
• d1pkva_ appears in SCOPe 2.02
  
• d1pkva_ appears in the current release, SCOPe 2.08