![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) ![]() |
![]() | Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains |
![]() | Protein Riboflavin synthase [63784] (2 species) trimerizes via the additional C-terminal helix |
![]() | Species Escherichia coli [TaxId:562] [63785] (4 PDB entries) |
![]() | Domain d1pkva_: 1pkv A: [104168] |
PDB Entry: 1pkv (more details), 2.6 Å
SCOP Domain Sequences for d1pkva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkva_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli} mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs fdlmketlritnlgdlkvgdwvnvera
Timeline for d1pkva_: