Lineage for d1pkva_ (1pkv A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464757Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 464870Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
  6. 464871Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 464872Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
  8. 464879Domain d1pkva_: 1pkv A: [104168]

Details for d1pkva_

PDB Entry: 1pkv (more details), 2.6 Å

PDB Description: The N-terminal domain of riboflavin synthase in complex with riboflavin

SCOP Domain Sequences for d1pkva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkva_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnvera

SCOP Domain Coordinates for d1pkva_:

Click to download the PDB-style file with coordinates for d1pkva_.
(The format of our PDB-style files is described here.)

Timeline for d1pkva_: