Lineage for d1pjja3 (1pjj A:224-271)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 524023Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 524024Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 524038Species Lactococcus lactis [TaxId:1358] [81619] (6 PDB entries)
  8. 524040Domain d1pjja3: 1pjj A:224-271 [104166]
    Other proteins in same PDB: d1pjja1, d1pjja2

Details for d1pjja3

PDB Entry: 1pjj (more details), 1.9 Å

PDB Description: complex between the lactococcus lactis fpg and an abasic site containing dna.

SCOP Domain Sequences for d1pjja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjja3 g.39.1.8 (A:224-271) DNA repair protein MutM (Fpg) {Lactococcus lactis}
algstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOP Domain Coordinates for d1pjja3:

Click to download the PDB-style file with coordinates for d1pjja3.
(The format of our PDB-style files is described here.)

Timeline for d1pjja3: