Lineage for d1pjja3 (1pjj A:224-271)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587144Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2587145Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 2587175Species Lactococcus lactis [TaxId:1358] [81619] (7 PDB entries)
    Uniprot P42371
  8. 2587178Domain d1pjja3: 1pjj A:224-271 [104166]
    Other proteins in same PDB: d1pjja1, d1pjja2
    protein/DNA complex; complexed with gol, zn

Details for d1pjja3

PDB Entry: 1pjj (more details), 1.9 Å

PDB Description: Complex between the Lactococcus lactis Fpg and an abasic site containing DNA.
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1pjja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjja3 g.39.1.8 (A:224-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
algstgkmqnelqvygktgekcsrcgaeiqkikvagrgthfcpvcqqk

SCOPe Domain Coordinates for d1pjja3:

Click to download the PDB-style file with coordinates for d1pjja3.
(The format of our PDB-style files is described here.)

Timeline for d1pjja3: