SCOP 1.75: Domain d1pjja2: 1pjj A:1-131

Lineage for d1pjja2 (1pjj A:1-131)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)

6. Protein DNA repair protein MutM (Fpg) [81621] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
   Uniprot P42371

8. Domain d1pjja2: 1pjj A:1-131 [104165]
   Other proteins in same PDB: d1pjja1, d1pjja3
   complexed with 3dr, gol, zn; mutant

Details for d1pjja2

PDB Entry: 1pjj, 1.9 Å

PDB Description: complex between the lactococcus lactis fpg and an abasic site containing dna.

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOP Domain Sequences for d1pjja2:

Sequence; same for both SEQRES and ATOM records:

>d1pjja2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

Timeline for d1pjja2:

• d1pjja2 first appeared in SCOP 1.69
  
• d1pjja2 appears in SCOP 1.73
  
• d1pjja2 appears in SCOPe 2.01
  
• d1pjja2 appears in the current release, SCOPe 2.08