Lineage for d1pjja2 (1pjj A:1-131)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472160Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 472161Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 472162Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 472163Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 472177Species Lactococcus lactis [TaxId:1358] [81617] (6 PDB entries)
  8. 472179Domain d1pjja2: 1pjj A:1-131 [104165]
    Other proteins in same PDB: d1pjja1, d1pjja3

Details for d1pjja2

PDB Entry: 1pjj (more details), 1.9 Å

PDB Description: Complex between the Lactococcus lactis Fpg and an abasic site containing DNA.

SCOP Domain Sequences for d1pjja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjja2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

SCOP Domain Coordinates for d1pjja2:

Click to download the PDB-style file with coordinates for d1pjja2.
(The format of our PDB-style files is described here.)

Timeline for d1pjja2: