SCOPe 2.01: Domain d1pjja1: 1pjj A:132-223

Lineage for d1pjja1 (1pjj A:132-223)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
   Uniprot P42371

8. Domain d1pjja1: 1pjj A:132-223 [104164]
   Other proteins in same PDB: d1pjja2, d1pjja3
   protein/DNA complex; complexed with gol, zn

Details for d1pjja1

PDB Entry: 1pjj, 1.9 Å

PDB Description: complex between the lactococcus lactis fpg and an abasic site containing dna.

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1pjja1:

Sequence; same for both SEQRES and ATOM records:

>d1pjja1 a.156.1.2 (A:132-223) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssirtys

Timeline for d1pjja1:

• d1pjja1 first appeared in SCOP 1.69
  
• d1pjja1 appears in SCOP 1.75
  
• d1pjja1 appears in SCOPe 2.02
  
• d1pjja1 appears in the current release, SCOPe 2.08