SCOP 1.71: Domain d1pjja1: 1pjj A:132-223

Lineage for d1pjja1 (1pjj A:132-223)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Lactococcus lactis [TaxId:1358] [81615] (6 PDB entries)

8. Domain d1pjja1: 1pjj A:132-223 [104164]
   Other proteins in same PDB: d1pjja2, d1pjja3
   complexed with 3dr, gol, zn; mutant

Details for d1pjja1

PDB Entry: 1pjj, 1.9 Å

PDB Description: complex between the lactococcus lactis fpg and an abasic site containing dna.

SCOP Domain Sequences for d1pjja1:

Sequence; same for both SEQRES and ATOM records:

>d1pjja1 a.156.1.2 (A:132-223) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssirtys

Timeline for d1pjja1:

• d1pjja1 first appeared in SCOP 1.69
  
• d1pjja1 appears in SCOP 1.73
  
• d1pjja1 appears in the current release, SCOPe 2.08