| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
| Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
| Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
| Species Lactococcus lactis [TaxId:1358] [81615] (6 PDB entries) |
| Domain d1pjja1: 1pjj A:132-223 [104164] Other proteins in same PDB: d1pjja2, d1pjja3 |
PDB Entry: 1pjj (more details), 1.9 Å
SCOP Domain Sequences for d1pjja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjja1 a.156.1.2 (A:132-223) DNA repair protein MutM (Fpg) {Lactococcus lactis}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggssirtys
Timeline for d1pjja1: