Lineage for d1pjia2 (1pji A:1-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821188Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2821189Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2821190Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2821191Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2821221Species Lactococcus lactis [TaxId:1358] [81617] (7 PDB entries)
    Uniprot P42371
  8. 2821225Domain d1pjia2: 1pji A:1-131 [104162]
    Other proteins in same PDB: d1pjia1, d1pjia3
    protein/DNA complex; complexed with gol, zn

Details for d1pjia2

PDB Entry: 1pji (more details), 1.9 Å

PDB Description: Crystal structure of wild type Lactococcus lactis FPG complexed to a 1,3 propanediol containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1pjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjia2 b.113.1.1 (A:1-131) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkki

SCOPe Domain Coordinates for d1pjia2:

Click to download the PDB-style file with coordinates for d1pjia2.
(The format of our PDB-style files is described here.)

Timeline for d1pjia2: