Class a: All alpha proteins [46456] (218 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
Protein DNA repair protein MutM (Fpg) [81620] (4 species) |
Species Lactococcus lactis [TaxId:1358] [81615] (6 PDB entries) |
Domain d1pjia1: 1pji A:132-218 [104161] Other proteins in same PDB: d1pjia2, d1pjia3 |
PDB Entry: 1pji (more details), 1.9 Å
SCOP Domain Sequences for d1pjia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjia1 a.156.1.2 (A:132-218) DNA repair protein MutM (Fpg) {Lactococcus lactis} gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq liessihllhdsiieilqkaiklggss
Timeline for d1pjia1: