Lineage for d1pjia1 (1pji A:132-218)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013619Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2013620Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2013695Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 protein domains)
    contains 4 helices in the core
  6. 2013696Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 2013726Species Lactococcus lactis [TaxId:1358] [81615] (7 PDB entries)
    Uniprot P42371
  8. 2013730Domain d1pjia1: 1pji A:132-218 [104161]
    Other proteins in same PDB: d1pjia2, d1pjia3
    protein/DNA complex; complexed with gol, zn

Details for d1pjia1

PDB Entry: 1pji (more details), 1.9 Å

PDB Description: Crystal structure of wild type Lactococcus lactis FPG complexed to a 1,3 propanediol containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d1pjia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjia1 a.156.1.2 (A:132-218) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]}
gpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwlakihpeketnq
liessihllhdsiieilqkaiklggss

SCOPe Domain Coordinates for d1pjia1:

Click to download the PDB-style file with coordinates for d1pjia1.
(The format of our PDB-style files is described here.)

Timeline for d1pjia1: