SCOPe 2.03: Domain d1piwb2: 1piw B:153-320

Lineage for d1piwb2 (1piw B:153-320)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Cinnamyl alcohol dehydrogenase, ADH6 [110403] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110404] (3 PDB entries)
   Uniprot Q04894

8. Domain d1piwb2: 1piw B:153-320 [104159]
   Other proteins in same PDB: d1piwa1, d1piwb1
   complexed with nap, zn

Details for d1piwb2

PDB Entry: 1piw, 3 Å

PDB Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae

PDB Compounds: (B:) Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region

SCOPe Domain Sequences for d1piwb2:

Sequence; same for both SEQRES and ATOM records:

>d1piwb2 c.2.1.1 (B:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ipshlaapllcggltvysplvrngcgpgkkvgivglggigsmgtliskamgaetyvisrs
srkredamkmgadhyiatleegdwgekyfdtfdlivvcassltdidfnimpkamkvggri
vsisipeqhemlslkpyglkavsisysalgsikelnqllklvsekdik

Timeline for d1piwb2:

• d1piwb2 first appeared in SCOP 1.69
  
• d1piwb2 appears in SCOPe 2.02
  
• d1piwb2 appears in SCOPe 2.04
  
• d1piwb2 appears in the current release, SCOPe 2.08