Lineage for d1piwb2 (1piw B:153-320)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 476941Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (14 proteins)
    N-terminal all-beta domain defines family
  6. 477145Protein Cinnamyl alcohol dehydrogenase, ADH6 [110403] (1 species)
  7. 477146Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110404] (3 PDB entries)
  8. 477149Domain d1piwb2: 1piw B:153-320 [104159]
    Other proteins in same PDB: d1piwa1, d1piwb1

Details for d1piwb2

PDB Entry: 1piw (more details), 3 Å

PDB Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae

SCOP Domain Sequences for d1piwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piwb2 c.2.1.1 (B:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae)}
ipshlaapllcggltvysplvrngcgpgkkvgivglggigsmgtliskamgaetyvisrs
srkredamkmgadhyiatleegdwgekyfdtfdlivvcassltdidfnimpkamkvggri
vsisipeqhemlslkpyglkavsisysalgsikelnqllklvsekdik

SCOP Domain Coordinates for d1piwb2:

Click to download the PDB-style file with coordinates for d1piwb2.
(The format of our PDB-style files is described here.)

Timeline for d1piwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1piwb1