![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Cinnamyl alcohol dehydrogenase, ADH6 [110173] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110174] (3 PDB entries) Uniprot Q04894 |
![]() | Domain d1piwb1: 1piw B:1-152,B:321-360 [104158] Other proteins in same PDB: d1piwa2, d1piwb2 complexed with nap, zn |
PDB Entry: 1piw (more details), 3 Å
SCOPe Domain Sequences for d1piwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1piwb1 b.35.1.2 (B:1-152,B:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt ysqpyedgyvsqggyanyvrvhehfvvpipenXiwvetlpvgeagvheafermekgdvry rftlvgydkefsd
Timeline for d1piwb1: