Lineage for d1piwb1 (1piw B:1-152,B:321-360)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666255Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 666484Protein Cinnamyl alcohol dehydrogenase, ADH6 [110173] (1 species)
  7. 666485Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110174] (3 PDB entries)
  8. 666488Domain d1piwb1: 1piw B:1-152,B:321-360 [104158]
    Other proteins in same PDB: d1piwa2, d1piwb2
    complexed with nap, zn

Details for d1piwb1

PDB Entry: 1piw (more details), 3 Å

PDB Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
PDB Compounds: (B:) Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region

SCOP Domain Sequences for d1piwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piwb1 b.35.1.2 (B:1-152,B:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
ysqpyedgyvsqggyanyvrvhehfvvpipenXiwvetlpvgeagvheafermekgdvry
rftlvgydkefsd

SCOP Domain Coordinates for d1piwb1:

Click to download the PDB-style file with coordinates for d1piwb1.
(The format of our PDB-style files is described here.)

Timeline for d1piwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1piwb2