SCOPe 2.08: Domain d1piwb1: 1piw B:1-152,B:321-360

Lineage for d1piwb1 (1piw B:1-152,B:321-360)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Cinnamyl alcohol dehydrogenase, ADH6 [110173] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110174] (3 PDB entries)
   Uniprot Q04894

8. Domain d1piwb1: 1piw B:1-152,B:321-360 [104158]
   Other proteins in same PDB: d1piwa2, d1piwb2
   complexed with nap, zn

Details for d1piwb1

PDB Entry: 1piw, 3 Å

PDB Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae

PDB Compounds: (B:) Hypothetical zinc-type alcohol dehydrogenase-like protein in PRE5-FET4 intergenic region

SCOPe Domain Sequences for d1piwb1:

Sequence; same for both SEQRES and ATOM records:

>d1piwb1 b.35.1.2 (B:1-152,B:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
ysqpyedgyvsqggyanyvrvhehfvvpipenXiwvetlpvgeagvheafermekgdvry
rftlvgydkefsd

Timeline for d1piwb1:

• d1piwb1 first appeared in SCOP 1.69
  
• d1piwb1 appears in SCOPe 2.07