Lineage for d1phqa_ (1phq A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475676Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 475753Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 475787Species Escherichia coli [TaxId:562] [51603] (7 PDB entries)
  8. 475796Domain d1phqa_: 1phq A: [104154]

Details for d1phqa_

PDB Entry: 1phq (more details), 2.7 Å

PDB Description: Crystal structure of KDO8P synthase in its binary complex with substrate analog E-FPEP

SCOP Domain Sequences for d1phqa_:

Sequence, based on SEQRES records: (download)

>d1phqa_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk

Sequence, based on observed residues (ATOM records): (download)

>d1phqa_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Escherichia coli}
mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpehakcdgp
salplaklepflkqmkaiddlvkgfeeldtsk

SCOP Domain Coordinates for d1phqa_:

Click to download the PDB-style file with coordinates for d1phqa_.
(The format of our PDB-style files is described here.)

Timeline for d1phqa_: