SCOP 1.73: Domain d1pg8b_: 1pg8 B:

Lineage for d1pg8b_ (1pg8 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)

6. Protein Methionine gamma-lyase, MGL [64126] (4 species)

7. Species Pseudomonas putida [TaxId:303] [75271] (4 PDB entries)

8. Domain d1pg8b_: 1pg8 B: [104151]

Details for d1pg8b_

PDB Entry: 1pg8, 2.68 Å

PDB Description: Crystal Structure of L-methionine alpha-, gamma-lyase

PDB Compounds: (B:) methionine gamma-lyase

SCOP Domain Sequences for d1pg8b_:

Sequence; same for both SEQRES and ATOM records:

>d1pg8b_ c.67.1.3 (B:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

Timeline for d1pg8b_:

• d1pg8b_ first appeared in SCOP 1.69
  
• d1pg8b_ appears in SCOP 1.71
  
• d1pg8b_ appears in SCOP 1.75
  
• d1pg8b_ appears in the current release, SCOPe 2.08