Lineage for d1pg5b2 (1pg5 B:105-160)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524338Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 524339Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 524340Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 524341Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [111453] (1 PDB entry)
  8. 524342Domain d1pg5b2: 1pg5 B:105-160 [104149]
    Other proteins in same PDB: d1pg5a1, d1pg5a2, d1pg5b1

Details for d1pg5b2

PDB Entry: 1pg5 (more details), 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius

SCOP Domain Sequences for d1pg5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg5b2 g.41.7.1 (B:105-160) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Archaeon Sulfolobus acidocaldarius}
kvvkgilkcpnpycitsndveaiptfktltekplkmrceycetiideneimsqilg

SCOP Domain Coordinates for d1pg5b2:

Click to download the PDB-style file with coordinates for d1pg5b2.
(The format of our PDB-style files is described here.)

Timeline for d1pg5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg5b1