Lineage for d1pg5b1 (1pg5 B:11-104)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504116Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [110950] (1 PDB entry)
  8. 504117Domain d1pg5b1: 1pg5 B:11-104 [104148]
    Other proteins in same PDB: d1pg5a1, d1pg5a2, d1pg5b2

Details for d1pg5b1

PDB Entry: 1pg5 (more details), 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius

SCOP Domain Sequences for d1pg5b1:

Sequence, based on SEQRES records: (download)

>d1pg5b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Archaeon Sulfolobus acidocaldarius}
mvskikngtvidhipagrafavlnvlgikghegfrialvinvdskkmgkkdivkiedkei
sdteanlitliaptatinivreyevvkktklevp

Sequence, based on observed residues (ATOM records): (download)

>d1pg5b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Archaeon Sulfolobus acidocaldarius}
mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
teanlitliaptatinivreyevvkktklevp

SCOP Domain Coordinates for d1pg5b1:

Click to download the PDB-style file with coordinates for d1pg5b1.
(The format of our PDB-style files is described here.)

Timeline for d1pg5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg5b2