Lineage for d1pg5b1 (1pg5 B:11-104)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172653Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2172654Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2172655Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2172792Species Sulfolobus acidocaldarius [TaxId:2285] [110950] (2 PDB entries)
  8. 2172793Domain d1pg5b1: 1pg5 B:11-104 [104148]
    Other proteins in same PDB: d1pg5a1, d1pg5a2, d1pg5b2
    complexed with zn

Details for d1pg5b1

PDB Entry: 1pg5 (more details), 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1pg5b1:

Sequence, based on SEQRES records: (download)

>d1pg5b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikghegfrialvinvdskkmgkkdivkiedkei
sdteanlitliaptatinivreyevvkktklevp

Sequence, based on observed residues (ATOM records): (download)

>d1pg5b1 d.58.2.1 (B:11-104) Aspartate carbamoyltransferase {Sulfolobus acidocaldarius [TaxId: 2285]}
mvskikngtvidhipagrafavlnvlgikegfrialvinvdskkmgkkdivkiedkeisd
teanlitliaptatinivreyevvkktklevp

SCOPe Domain Coordinates for d1pg5b1:

Click to download the PDB-style file with coordinates for d1pg5b1.
(The format of our PDB-style files is described here.)

Timeline for d1pg5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg5b2