Lineage for d1pg5a1 (1pg5 A:1-146)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493147Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [110719] (1 PDB entry)
  8. 493148Domain d1pg5a1: 1pg5 A:1-146 [104146]
    Other proteins in same PDB: d1pg5b1, d1pg5b2

Details for d1pg5a1

PDB Entry: 1pg5 (more details), 2.6 Å

PDB Description: crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius

SCOP Domain Sequences for d1pg5a1:

Sequence, based on SEQRES records: (download)

>d1pg5a1 c.78.1.1 (A:1-146) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius}
lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
inlggdvigfsgeestsvakgenladtirmlnnysdgivmrhkydgasrfaseisdipvi
nagdgkhehptqavidiytinkhfnt

Sequence, based on observed residues (ATOM records): (download)

>d1pg5a1 c.78.1.1 (A:1-146) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius}
lkhiisaynfsrdeledifaltdkysknlndtrkilsgktisiaffepstrtylsfqkai
inlggdvigfsgegenladtirmlnnysdgivmrhkydgasrfaseisdipvinagdgkh
ehptqavidiytinkhfnt

SCOP Domain Coordinates for d1pg5a1:

Click to download the PDB-style file with coordinates for d1pg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1pg5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg5a2