Lineage for d1pfja_ (1pfj A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467622Family b.55.1.9: TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110272] (1 protein)
  6. 467623Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 467624Species Human (Homo sapiens) [TaxId:9606] [110274] (1 PDB entry)
  8. 467625Domain d1pfja_: 1pfj A: [104145]

Details for d1pfja_

PDB Entry: 1pfj (more details)

PDB Description: Solution structure of the N-terminal PH/PTB domain of the TFIIH P62 subunit

SCOP Domain Sequences for d1pfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfja_ b.55.1.9 (A:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens)}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOP Domain Coordinates for d1pfja_:

Click to download the PDB-style file with coordinates for d1pfja_.
(The format of our PDB-style files is described here.)

Timeline for d1pfja_: