Lineage for d1pfja_ (1pfj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803640Family b.55.1.9: TFIIH domain [110272] (3 proteins)
  6. 2803654Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 2803655Species Human (Homo sapiens) [TaxId:9606] [110274] (5 PDB entries)
    Uniprot P32780 1-108
  8. 2803660Domain d1pfja_: 1pfj A: [104145]

Details for d1pfja_

PDB Entry: 1pfj (more details)

PDB Description: solution structure of the n-terminal ph/ptb domain of the tfiih p62 subunit
PDB Compounds: (A:) TFIIH basal transcription factor complex p62 subunit

SCOPe Domain Sequences for d1pfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfja_ b.55.1.9 (A:) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d1pfja_:

Click to download the PDB-style file with coordinates for d1pfja_.
(The format of our PDB-style files is described here.)

Timeline for d1pfja_: