Lineage for d1pffa_ (1pff A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895835Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2895904Species Trichomonas vaginalis, MGL2 [TaxId:5722] [110683] (1 PDB entry)
    Uniprot O15565
  8. 2895905Domain d1pffa_: 1pff A: [104143]
    complexed with edo, peg

Details for d1pffa_

PDB Entry: 1pff (more details), 2.5 Å

PDB Description: Crystal Structure of Homocysteine alpha-, gamma-lyase at 1.8 Angstroms
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d1pffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]}
salegkiaklehaeacaatasgmgaiaasvwtflkagdhlisddclygcthalfehqlrk
fgvevdfidmavpgniekhlkpntrivyfetpanptlkvidiedavkqarkqkdilvivd
ntfaspiltnpldlgvdivvhsatkyinghtdvvaglvcsradiiakvksqgikditgai
isphdawlitrgtltldmrvkraaenaqkvaeflhehkavkkvyypglpdhpgheiakkq
mkmfgsmiafdvdglekakkvldnchvvslavslggpesliqhpasmthagvpkeereaa
gltdnlirlsvgcenvqdiiddlkqaldlvl

SCOPe Domain Coordinates for d1pffa_:

Click to download the PDB-style file with coordinates for d1pffa_.
(The format of our PDB-style files is described here.)

Timeline for d1pffa_: