SCOP 1.73: Domain d1peya_: 1pey A:

Lineage for d1peya_ (1pey A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)

8. Domain d1peya_: 1pey A: [104137]

Details for d1peya_

PDB Entry: 1pey, 2.25 Å

PDB Description: crystal structure of the response regulator spo0f complexed with mn2+

PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOP Domain Sequences for d1peya_:

Sequence; same for both SEQRES and ATOM records:

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

Timeline for d1peya_:

• d1peya_ first appeared in SCOP 1.69
  
• d1peya_ appears in SCOP 1.71
  
• d1peya_ appears in SCOP 1.75
  
• d1peya_ appears in the current release, SCOPe 2.08