SCOP 1.71: Domain d1pewb_: 1pew B:

Lineage for d1pewb_ (1pew B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)

8. Domain d1pewb_: 1pew B: [104136]
   complexed with cd; mutant

Details for d1pewb_

PDB Entry: 1pew, 1.6 Å

PDB Description: High Resolution Crystal Structure of Jto2, a mutant of the non-amyloidogenic Lamba6 Light Chain, Jto

SCOP Domain Sequences for d1pewb_:

Sequence, based on SEQRES records:

>d1pewb_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqrsapitviyednqrpsgvpdr
fagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Sequence, based on observed residues (ATOM records):

>d1pewb_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqsapitviyednqrpsgvpdrf
agsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Timeline for d1pewb_:

• d1pewb_ first appeared in SCOP 1.69
  
• d1pewb_ appears in SCOP 1.73
  
• d1pewb_ appears in the current release, SCOPe 2.08