Lineage for d1pewb_ (1pew B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547970Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 547974Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
  8. 547976Domain d1pewb_: 1pew B: [104136]
    complexed with cd; mutant

Details for d1pewb_

PDB Entry: 1pew (more details), 1.6 Å

PDB Description: High Resolution Crystal Structure of Jto2, a mutant of the non-amyloidogenic Lamba6 Light Chain, Jto

SCOP Domain Sequences for d1pewb_:

Sequence, based on SEQRES records: (download)

>d1pewb_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqrsapitviyednqrpsgvpdr
fagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Sequence, based on observed residues (ATOM records): (download)

>d1pewb_ b.1.1.1 (B:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1}
nfmlnqphsvsespgktvtisctrssgniasnyvqwyqqsapitviyednqrpsgvpdrf
agsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

SCOP Domain Coordinates for d1pewb_:

Click to download the PDB-style file with coordinates for d1pewb_.
(The format of our PDB-style files is described here.)

Timeline for d1pewb_: