SCOPe 2.06: Domain d1peua2: 1peu A:175-699

Lineage for d1peua2 (1peu A:175-699)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
   contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel

4. Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families)
   duplication: the N- and C-terminal halves have similar topologies

5. Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
   automatically mapped to Pfam PF02867

6. Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [110447] (5 PDB entries)
   Uniprot Q08698

8. Domain d1peua2: 1peu A:175-699 [104134]
   Other proteins in same PDB: d1peua1
   complexed with dtp, mg

Details for d1peua2

PDB Entry: 1peu, 3.2 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 alpha chain

SCOPe Domain Sequences for d1peua2:

Sequence; same for both SEQRES and ATOM records:

>d1peua2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
lvscfllriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipv
mkmledafsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipd
itfrlakenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtl
aeiqfesgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdis
cnlgslniahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnl
hgylaregiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyf
tqylqddwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisy
inhatssihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeat
rhvdqglsltlffpdtattrdinkaqiyawrkgikslyyirlrql

Timeline for d1peua2:

• d1peua2 first appeared in SCOP 1.69
  
• d1peua2 appears in SCOPe 2.05
  
• d1peua2 appears in SCOPe 2.07
  
• d1peua2 appears in the current release, SCOPe 2.08