Lineage for d1peua1 (1peu A:13-174)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645525Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 645526Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 645527Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 645528Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 645552Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries)
  8. 645556Domain d1peua1: 1peu A:13-174 [104133]
    Other proteins in same PDB: d1peua2
    complexed with dtp, mg

Details for d1peua1

PDB Entry: 1peu (more details), 3.2 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 alpha chain

SCOP Domain Sequences for d1peua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peua1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

SCOP Domain Coordinates for d1peua1:

Click to download the PDB-style file with coordinates for d1peua1.
(The format of our PDB-style files is described here.)

Timeline for d1peua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1peua2