SCOP 1.69: Domain d1peqa1: 1peq A:13-174

Lineage for d1peqa1 (1peq A:13-174)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [109946] (4 PDB entries)

8. Domain d1peqa1: 1peq A:13-174 [104131]
   Other proteins in same PDB: d1peqa2

Details for d1peqa1

PDB Entry: 1peq, 2.8 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium

SCOP Domain Sequences for d1peqa1:

Sequence; same for both SEQRES and ATOM records:

>d1peqa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

Timeline for d1peqa1:

• d1peqa1 is new in SCOP 1.69
  
• d1peqa1 appears in SCOP 1.71
  
• d1peqa1 appears in the current release, SCOPe 2.08