Class a: All alpha proteins [46456] (226 folds) |
Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) |
Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [109946] (4 PDB entries) |
Domain d1peoa1: 1peo A:13-174 [104129] Other proteins in same PDB: d1peoa2 complexed with dcp, mg |
PDB Entry: 1peo (more details), 3 Å
SCOP Domain Sequences for d1peoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peoa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium} tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d1peoa1: