Lineage for d1peoa1 (1peo A:13-174)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721200Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 2721201Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 2721202Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 2721203Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 2721234Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries)
  8. 2721236Domain d1peoa1: 1peo A:13-174 [104129]
    Other proteins in same PDB: d1peoa2
    complexed with dcp, mg

Details for d1peoa1

PDB Entry: 1peo (more details), 3 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 alpha chain

SCOPe Domain Sequences for d1peoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peoa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

SCOPe Domain Coordinates for d1peoa1:

Click to download the PDB-style file with coordinates for d1peoa1.
(The format of our PDB-style files is described here.)

Timeline for d1peoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1peoa2