Lineage for d1pema2 (1pem A:175-699)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097807Family c.7.1.2: R1 subunit of ribonucleotide reductase, C-terminal domain [52002] (1 protein)
    automatically mapped to Pfam PF02867
  6. 2097808Protein R1 subunit of ribonucleotide reductase, C-terminal domain [52003] (2 species)
  7. 2097835Species Salmonella typhimurium [TaxId:90371] [110447] (5 PDB entries)
    Uniprot Q08698
  8. 2097838Domain d1pema2: 1pem A:175-699 [104128]
    Other proteins in same PDB: d1pema1

Details for d1pema2

PDB Entry: 1pem (more details), 2.99 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 alpha chain

SCOPe Domain Sequences for d1pema2:

Sequence, based on SEQRES records: (download)

>d1pema2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
lvscfllriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipv
mkmledafsyanqlgarqgagavylhahhpdilrfldtkrenadekiriktlslgvvipd
itfrlakenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtl
aeiqfesgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdis
cnlgslniahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnl
hgylaregiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyf
tqylqddwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisy
inhatssihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeat
rhvdqglsltlffpdtattrdinkaqiyawrkgikslyyirlrql

Sequence, based on observed residues (ATOM records): (download)

>d1pema2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
lvscfllriednmesigravnsalqlskrgggvafllsnlreagapikrienqssgvipv
mkmledafsyanqgagavylhahhpdilrfldtkrenadekiriktlslgvvipditfrl
akenaqmalfspydiqrrygkpfgdiaiserydeliadphvrktyinardffqtlaeiqf
esgypyimfedtvnranpiagrinmsnlcseilqvnsasryddnldythighdiscnlgs
lniahvmdspdigrtvetairgltavsdmshirsvpsiaagnaashaiglgqmnlhgyla
regiaygspealdftnlyfytitwhavhtsmrlarergktfagfaqsryasgdyftqylq
ddwqpktakvralfarsgitlptremwlklrddvmrygiynqnlqavpptgsisyinhat
ssihpivakieirkegktgrvyypapfmtnenldmyqdaydigpekiidtyaeatrhvdq
glsltlffpdtattrdinkaqiyawrkgikslyyirlrql

SCOPe Domain Coordinates for d1pema2:

Click to download the PDB-style file with coordinates for d1pema2.
(The format of our PDB-style files is described here.)

Timeline for d1pema2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pema1