Lineage for d1peea_ (1pee A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 467813Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
    barrel, closed; n=8, S=12, meander
  6. 467928Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 467929Species Rhodnius prolixus [TaxId:13249] [50844] (3 PDB entries)
  8. 467931Domain d1peea_: 1pee A: [104126]

Details for d1peea_

PDB Entry: 1pee (more details), 1.5 Å

PDB Description: Crystal Structure of Nitrophorin 2 complex with imidazole

SCOP Domain Sequences for d1peea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peea_ b.60.1.1 (A:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOP Domain Coordinates for d1peea_:

Click to download the PDB-style file with coordinates for d1peea_.
(The format of our PDB-style files is described here.)

Timeline for d1peea_: